PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0032s0350.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 318aa    MW: 34686.5 Da    PI: 9.3865
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0032s0350.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.5e-392181262
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  SapurV1A.0032s0350.4.p 21 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 81
                            7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.3E-342379IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-282479IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5252579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MASTSKLMER PSQEVLSQTQ QQQALKCPRC DSSNTKFCYY NNYSLSQPRH FCKACKRYWT  60
RGGTLRNVPV GGGCRKNKRV KRPASAVEGA SNSVSSANPN PQTPIDHISS TSNHINPLLY  120
GLSSSNPSEM NLPFPGRFNS RMDSAVSGYH NLQPQLNALA LGFSSGIMST NDANGFNPTK  180
QIQDVVTSNS LLSSYSNLFG SSTTSTNTAS PIASLLASSF NQQNFTNGGI KESKRAPNYF  240
QNMTIPFEEL QMNGNSESGI GIKGVKNDHD QNRLNWNVPC QNQIEQVGFS DPSMYWSTTT  300
SVGSWHDPAN TRSSVLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1647380.0KT164738.1 Populus tomentosa clone Potom.011G26508 F-box family protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006377384.10.0hypothetical protein POPTR_0011s05450g
TrEMBLB9N3H40.0B9N3H4_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05450.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-39Dof family protein